PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10028573m
Common NameCARUB_v10028573mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 259aa    MW: 28591.8 Da    PI: 4.5732
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10028573mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.8e-101443130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     +g+WT+eEd++l+ +v+++G g W+t +++
  Carubv10028573m 14 KGAWTPEEDQKLIAYVQLHGEGGWRTLPEK 43
                     79************************9876 PP

2Myb_DNA-binding48.91.5e-154892147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg +T+eEd+ ++++++  G++ W++Ia+ +  gRt++++k++w++ 
  Carubv10028573m 48 RGEFTPEEDDTIIKLHAIKGNK-WAAIAASLA-GRTDNEIKNYWNTN 92
                     899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-11543IPR009057Homeodomain-like
SuperFamilySSF466895.5E-201189IPR009057Homeodomain-like
SMARTSM00717201345IPR001005SANT/Myb domain
PfamPF002497.7E-81442IPR001005SANT/Myb domain
PROSITE profilePS5129423.6694397IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-224498IPR009057Homeodomain-like
SMARTSM007174.5E-164795IPR001005SANT/Myb domain
PfamPF002491.1E-144893IPR001005SANT/Myb domain
CDDcd001671.96E-115093No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MVRTPCCKEE GIKKGAWTPE EDQKLIAYVQ LHGEGGWRTL PEKADIKRGE FTPEEDDTII  60
KLHAIKGNKW AAIAASLAGR TDNEIKNYWN TNLKKRIKQI KKGLVDPITH NSSSTGTQNA  120
IEPTNNNKPV RSSGSARLLN RVASKYAVDF NRDLLIGLIS SGNRTGEIDP RDSTLLNIMV  180
ETSSSVYNNS SSTLSDDISD NSCFNEFFSN EEIISDDVYT TIDNIDFMEE LKEILNGSGA  240
EIIENASNAA DEIGCWNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-1614977108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0082693e-55AB008269.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MSL3.
GenBankAK2273373e-55AK227337.1 Arabidopsis thaliana mRNA for Myb transcription factor homolog, clone: RAFL14-02-G07.
GenBankATU664623e-55U66462.1 Arabidopsis thaliana Myb transcription factor homolog (ATR1) gene, complete cds, receptor-like protein kinase (RLK1) gene, partial cds.
GenBankAY5196423e-55AY519642.1 Arabidopsis thaliana MYB transcription factor (At5g60890) mRNA, complete cds.
GenBankBT0303263e-55BT030326.1 Arabidopsis thaliana unknown protein (At5g60890) mRNA, complete cds.
GenBankCP0026883e-55CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279548.10.0hypothetical protein CARUB_v10028573mg
SwissprotO643991e-102MYB34_ARATH; Transcription factor MYB34
TrEMBLR0EUJ10.0R0EUJ1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.8__2056__AT5G60890.11e-111(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93311637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.12e-99myb domain protein 34